PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g09930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family ARF
Protein Properties Length: 251aa    MW: 29103.2 Da    PI: 8.4906
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g09930genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.75.9e-1546983183
               .--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE CS
         B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk 83
               + +++++ +d++  +W++k+i+r++++++++t+GW+ F k +gL +gD++vF 
  Tp6g09930 46 TPTQEIVAKDLHVYEWRFKHIFRGTPRMHLFTRGWNAFMKTKGLPVGDSFVFI 98
               33459***********************************************7 PP

2Auxin_resp63.76.9e-221001612183
  Auxin_resp  21 tseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  s+F+ +++++++a+++k+++G++f m fe +d+s++r+sGt++g++d  +++W+nS+WrsL+
   Tp6g09930 100 LSQFIASCDRFVNAVNNKFIIGSKFTMWFEDNDFSKIRYSGTIIGIQD-FSIHWKNSEWRSLE 161
                 59**********************************************.667*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-1440101IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-1441102IPR015300DNA-binding pseudobarrel domain
PfamPF023621.1E-124498IPR003340B3 DNA binding domain
CDDcd100172.99E-84597No hitNo description
PfamPF065076.8E-18101160IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKPIFDLPSK IRCTVIGIQL KVENDTDQIY TQITLLPDIT DMSHPTPTQE IVAKDLHVYE  60
WRFKHIFRGT PRMHLFTRGW NAFMKTKGLP VGDSFVFIRL SQFIASCDRF VNAVNNKFII  120
GSKFTMWFED NDFSKIRYSG TIIGIQDFSI HWKNSEWRSL EVQWDEAASI PRPNKVSPWE  180
IQHLPPSLNV SNTSFLNNKR LRHVDENGAN WWIPKLNQCQ EIGQSSINAS MSVPQLSYHH  240
ATNDLKIPSD L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A4e-40318465355Auxin response factor 1
4ldw_A4e-40318465355Auxin response factor 1
4ldw_B4e-40318465355Auxin response factor 1
4ldx_A4e-40318465355Auxin response factor 1
4ldx_B4e-40318465355Auxin response factor 1
4ldy_A4e-40318465355Auxin response factor 1
4ldy_B4e-40318465355Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006396921.18e-84hypothetical protein EUTSA_v10029161mg
SwissprotQ9C8N73e-81ARFV_ARATH; Auxin response factor 22
TrEMBLV4L3X39e-84V4L3X3_EUTSA; Auxin response factor
STRINGAT1G34390.16e-79(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12276731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34390.12e-82auxin response factor 22